Buscar en
TIP. Revista Especializada en Ciencias Químico-Biológicas
Toda la web
Inicio TIP. Revista Especializada en Ciencias Químico-Biológicas RED DE COEXPRESIÓN DE 320 GENES DE Tectona grandis RELACIONADOS CON PROCESOS DE...
Información de la revista
Vol. 20. Núm. 2.
Páginas 5-14 (Julio - Diciembre 2017)
Compartir
Compartir
Descargar PDF
Más opciones de artículo
Visitas
4636
Vol. 20. Núm. 2.
Páginas 5-14 (Julio - Diciembre 2017)
ARTÍCULO ORIGINAL
Open Access
RED DE COEXPRESIÓN DE 320 GENES DE Tectona grandis RELACIONADOS CON PROCESOS DE ESTRÉS ABIÓTICO Y XILOGÉNESIS
Coexpression Network of 320 genes of Tectona grandis involved in abiotic stress and xylogenesis processes
Visitas
4636
Vladimir Camela, Esteban Galeanob, Helaine Carrerb
a Instituto de Biotecnología e Ingeniería Genética (IBIG), Facultad de Ciencias Forestales y del Ambiente, Universidad Nacional del Centro del Perú, Av. Mariscal Castilla #3909, Huancayo, Región Junín, Perú
b Centro de Biotecnología Agrícola (CEBTEC), Escola Superior de Agricultura “Luiz de Queiroz”, Universidade de São Paulo, Av. Padua Dias #11, Piracicaba, Edo. De São Paulo, Brazil
Este artículo ha recibido

Under a Creative Commons license
Información del artículo
Resumen
Texto completo
Bibliografía
Descargar PDF
Estadísticas
Figuras (3)
Mostrar másMostrar menos
Tablas (2)
Tabla I. Motivos conservados evolutivamente de 18 factores de transcripción de T. grandis, pertenecientes a las familias MyB, HSF, HShT, ERF, bZIP, NAC, bHLH, Gata, Nuy, IIETFs y ARF
Tabla II. Nodos de ontologías génicas más significativos. Son incluidos sus valores p y frecuencias de clúster, donde las descripciones con mayor porcentaje son representados por las actividades metabólicas y procesos celulares
Mostrar másMostrar menos
RESUMEN

Tectona grandis es un árbol maderable de importancia económica en bosques tropicales y subtropicales. Mediante este estudio, se identificaron familias de factores de transcripción (FTs) y genes codificantes para enzima, diferencialmente expresados en el xilema del tallo, implicados en la regulación de la respuesta a estrés abiótico y xilogénesis en T. grandis. Así, fue analizada la distribución evolutiva de 19 genes codificantes para FTs de T. grandis mediante análisis filogenéticos. También, fue utilizada la minería de bases de datos y publicaciones para identificar 320 genes de Arabidopsis thaliana (ortólogos a T. grandis) como soporte experimental y predictivo. Como resultados, se encontraron FTs de las familias bZIP, MYB, NAC, ER, bHLH, NuY y genes que codifican enzimas. Así mismo, se logró analizar el interactoma de T. grandis encontrando correlaciones de Pearson significativas para genes que regulan vías metabólicas de fenilpropanoides y estrés abiótico. Además, la red de coexpresión reveló nodos y aristas entre los genes TgRAP1, TgMyB1, TgHSF1, TgMyB3, TgNAC1, TgTsiid1, TgLieTFs1, TgNuy3, TgRAP2 y TgNuy4. En particular, los análisis de ontología génica mostraron 31 genes de respuesta a estrés abiótico, principalmente TgHShT1, TgHSF1 y TgHSF2 como correguladores. Además, se encontró que el regulador maestro TgNAC1, está involucrado en la corregulación de otros factores de transcripción.

Palabras clave:
biología de sistemas
enriquecimiento funcional
genes diferencialmente expresados
minería de literatura
ontología génica
ABSTRACT

Teak (Tectona grandis) is a timber tree of economic importance in tropical and subtropical forests. The aim of this work was to identify families of transcription factors (TFs) and enzyme-coding genes differentially expressed (DREs) in stem xylem and their regulation involved in abiotic stress response and xylogenesis in T. grandis. Therefore, the evolutionary distribution of 19 TFs of T. grandis was derived using a phylogenetic analysis. Besides, specific data mining procedures of databases and publications were performed in order to identify 320 Arabidopsis thaliana genes (orthologous to T. grandis) as experimental and predictive support. As results, we found transcription factors of the bZIP, MYB, NAC, ER, bHLH families, and enzyme-coding genes. Furthermore, interactome analysis in T. grandis showed a significant Pearson correlation for genes regulating metabolic pathways of phenylpropanoids and abiotic stress. Also, the coexpression network revealed nodes and edges between TgRAP1, TgMyB1, TgHSF1, TgMyB3, TgNAC1, TgTsiid1, TgLieTFs1, TgNuy3, TgRAP2 and TgNuy4 genes. Gene ontology analyses showed that 31 genes respond to abiotic stress, mainly TgHShT1, TgHSF1 and TgHSF2, as co-regulators. In addition, the TFs master regulator TgNAC1 was found to be involved in the co-regulation of other TFs.

Keywords:
systems biology
functional enrichment
differentially expressed genes
text mining
gene ontology
Texto completo
INTRODUCCIÓN

La Teca (Tectona grandis) es un árbol caducifolio de bosques tropicales y subtropicales, que posee un rápido crecimiento y es apreciado por su madera (Anish et al., 2015). Además, esta especie tiene un gran potencial para captura de carbono e incrementar su biomasa para formación de energía renovable y sustentable (Krause et al., 2006; Quiala et al., 2012). A pesar de los numerosos estudios fenotípicos en T. grandis, poco se conoce de la especie a un nivel molecular y bioquímico (Diningrat et al., 2015; Galeano et al., 2014). Así, la tecnología de RNAseq (secuenciación de RNA) permite revelar genes diferencialmente expresados (DERs) (Wan et al., 2012) y dentro de ellos, identificar algunos factores de transcripción (FTs) implicados en respuestas fisiológicas a diferentes factores ambientales o cambios metabólicos (Diningrat et al., 2015; Galeano et al., 2015). Algunos procesos que podrían ser regulados por este tipo de factores de transcripción son el depósito de celulosa, hemicelusosa y lignina en la pared celular. Este tipo de genes reguladores pueden activarse por variación en la concentración de sales en la célula, estrés hídrico, deficiencia de nutrientes, oxidación, alta osmolaridad o cambios de condiciones de luz y temperaturas extremas (Gill & Tuteja, 2010; Prasch & Sonnewald, 2013).

Generalmente, los FTs reconocen a los promotores corriente arriba (del inglés, upstream) en las secuencias de genes que serán regulados y pueden ser activados por procesos biológicos y ambientales (Matsui et al., 2008). Además, se han observado interacciones de algunas familias de FTs para dar respuesta fisiológica a diferentes tipos de estrés y a procesos metabólicos secundarios, como el depósito de lignina y posterior producción de madera (Lin et al., 2015; Sundar et al., 2008). Los factores de transcripción son proteínas que al unirse al DNA pueden interactuar con otros reguladores transcripcionales (como pueden ser los reguladores maestros), en procesos como remodelación de la cromatina, modificación de proteínas, reclutamiento o bloqueo de las RNA polimerasas que acceden a la cadena de DNA para el proceso de transcripción (Udvardi et al., 2007).

Por otro lado, la tecnología de RNAseq es una técnica cuantitativa que ayuda a determinar niveles de expresión de RNA y su aplicación directa puede direccionarse a la construcción de bases de datos a gran escala para hacer estudios de redes de coexpresión (Dameron et al., 2013; Mizrachi et al., 2010). Dentro de las largas listas de genes detectadas por el RNAseq en diferentes condiciones ambientales, de edad o de tejidos, se pueden analizar por bioinformática patrones de expresión similares entre sí (también llamado coexpresión); genes con patrones y funciones biológicas similares pueden ser anotados por ontologías génicas y luego ser agrupados (Consortium, 2000; Dameron et al., 2013). Además, la sistematización y agrupación de los genes coexpresados, pueden estar apoyados con resultados experimentales (Consortium, 2000; Dameron et al., 2013), y de ese modo poder elucidar rutas moleculares que rigen a los organismos vivos (Fröhlich et al., 2007; Jin et al., 2014). Actualmente, se conocen 58 familias de FTs en plantas (Jin et al., 2014; Naika et al., 2013), de las cuales algunas de ellas cumplen funciones importantes en la regulación de la expresión génica, especialmente al inicio de la transcripción. Por ejemplo, la familia bZIP, caracterizada por poseer un zíper de leucinas, y la familia bHLH, distinguida por tener dos hélices alfa unidos como dímeros al DNA, se encuentran en todos los organismos eucariontes, regulando procesos fisiológicos y de desarrollo central (Ariel et al., 2007; Sauvé et al., 2004). Así, el objetivo de este trabajo bioinformático fue identificar familias de factores de transcripción (FTs) y genes enzimáticos diferencialmente expresados (DERs) en el xilema del tallo de Teca y de los que deriven posibles implicados en la regulación a la respuesta de estrés abiótico. Finalmente, es importante analizar, sistematizar e integrar los diversos datos de las redes de coexpresión génica y la información generada de diferentes experimentos de expresión génica.

MATERIALES Y MÉTODOSSelección de genes de interés diferencialmente expresados en el xilema secundario del tallo de Tectona grandis

La búsqueda y selección de genes enzimáticos de interés relacionados con la respuesta a estrés abiótico y la regulación de las vías metabólicas de síntesis del xilema secundario del tallo, fue realizado a partir del transcriptoma de T. grandis, el cual está depositado en el “Transcriptome Shotgun Assembly” (TSA número de acceso GDLT00000000), disponible en el NCBI (www.ncbi.nlm.nih.gov), obtenido por Galeano y colaboradores en el año 2015 (Galeano et al., 2015). De esta base de datos, fueron descargados 2,413 genes diferencialmente expresados. Las funciones de estos genes fueron posteriormente anotadas mediante el software Blast2Go (https://www.blast2go.com/blast2go-pro).

Identificación de factores de transcripción en T. grandis e identificación de ortólogos en Arabidopsis thaliana

Un total de 19 factores de transcripción de tipo basales, activadores, coactivadores y reguladores maestros, fueron seleccionados manualmente a partir de las anotaciones realizadas con el Blast2Go a los genes diferencialmente expresados de Teca. Posteriormente, la secuencia codificante de los 19 FTs de Teca fue utilizada como referencia en las bases de datos “TAIR” (http://www.arabidopsis.org/) y “plant TFTDB” (http://planttfdb.cbi.pku.edu.cn/), para seleccionar los FTs ortólogos en A. thaliana que tuvieran un porcentaje de identidad mayor a un 70%.

Minería de literatura (Text mining)

Fue realizada una búsqueda de artículos relacionados con factores de transcripción y genes enzimáticos de A. thaliana ortólogos a los genes de Teca, que estuvieran implicados experimentalmente en la regulación de las vías metabólicas relacionadas con defensa de plantas, respuestas a estrés y síntesis de xilema secundario. Para ello, se utilizó la herramienta basada en internet para minería de literatura denominada PubTator (www.PubTator/index.cgi) (Wei et al., 2012). Así, en esta búsqueda avanzada se utilizaron como palabras clave los códigos de los genes y proteínas establecidos por el NCBI. Además, se utilizaron los descriptores biológicos “gen ortólogo”, “factor de transcripción” y “genética vegetal” como filtros para disminuir el número de publicaciones. Asimismo, fueron rastreadas bases de datos en A. thaliana con relación a redes de coexpresión (http://atted.jp/) y respuesta de estrés abiótico (http://caps.ncbs.res.in/stifdb/browse.html#genename). Se utilizaron las bases de datos de Arabidopsis por ser una planta modelo, con numerosos recursos bioinformáticos disponibles.

Dendrogramas y dominios conservados de los factores de transcripción diferencialmente expresados de T. grandis

La identificación de las secuencias codificantes para proteína (del inglés Coding sequence, o CDS) fueron obtenidas con el uso del programa ORF Finder (http://www.ncbi.nlm.nih.gov/gorf/orfig.cgi) y la traducción de nucleótidos a aminoácidos del CDS fue realizado con el programa ExPasy (http://web.expasy.org/translate/). Posteriormente, la búsqueda de similitud proteica y de dominios se realizó con la base de datos de pFam (http://pfam.xfam.org/). De los 19 factores de transcripción identificados entre los genes diferencialmente expresados, se seleccionaron de 4 a 8 genes ortólogos con porcentaje de identidad mayor a 70% correspondientes a cada FTs. Luego, se realizaron alineamientos múltiples para cada FTs con el programa Clustal Omega y edición de secuencias mediante el programa Bioedit. Los alineamientos fueron almacenados en formato “.aln” y posteriormente transformados al formato “.meg” con el uso del software MEGA6, versión 6.06 (http://www.megasoftware.net/mega.php). Finalmente, con este programa se obtuvo un dendrograma según el método de Neighbor Joining.

Análisis de redes de interacción entre A. thaliana y T. grandis

Para obtener la red de interacciones (tipo coexpresión, interacciones físicas, predicciones y dominios de proteína compartidos) de los factores de transcripción de T. grandis, se utilizaron como referencia los 19 factores de transcripción de A. thaliana ortólogos a Teca. Para obtener el interactoma de Teca, se utilizó el complemento Genemania en el software Cytoscape (http://www.cytoscape.org/), el cual utiliza la información disponible sobre la regulación génica de A. thaliana (como especie modelo) para predecir y ajustar las gráficas de interacción de otras especies de plantas, de las cuales no se conoce su regulación. Genemania utiliza el principio de redes de peso (del inglés weight networks) para ponderar las predicciones y calcular el coeficiente de correlación de Pearson para cada par de genes.

Enriquecimiento funcional basado en categorías de ontología génica

El análisis de enriquecimiento funcional basado en categorías de ontología génica (del inglés, Gene Ontology) de los 19 FTs y 301 genes enzimáticos de A. thaliana fue realizado mediante la herramienta web de ontología génica atriGO (http://bioinfo.cau.edu.cn/agriGO/) y el complemento “Bingo” del software Cytoscape (http://www.BiNGO/Home.html). El sondeo de enriquecimiento por minería de datos se realizó a un valor p de corte ≤ 0,01 después de aplicar la corrección Benjamini - Hochberg.

RESULTADOSGenes diferencialmente expresados obtenidos del xilema secundario del tallo de T. grandis y minería de literatura

Se seleccionaron 19 FTs de T. grandis que pertenecen a 13 familias, incluyendo bHLH, MyB, HSF, NAC, Mad box, bZIP, ARF, ERF, NY, IIIBTFs, IIETfs, gata zinc, Tsiid (Archivos adicionales 1) y 301 genes enzimáticos (Archivos adicionales 2), en donde los genes ortólogos comparten regiones de dominio funcional por encima del 70% de similitud. Por otro lado, se encontraron 1,641 publicaciones relacionadas con investigaciones de respuesta a factores de estrés usando como modelo A. thaliana depositados en PubTator. Posteriormente, se obtuvieron 1,683 FTs distribuidos en 19 familias relacionados con estrés biótico y abiótico, regulando la expresión de 4,172 genes con funciones de señalización de ácido abscísico, estrés por frío y sequía, respuesta a la luz, variaciones en las concentraciones de sales celulares, estrés oxidativo y rehidratación, entre otros (Sowdhamini et al., 2009). Trabajos recientes en árboles como Populus trichocarpa y Pinus taeda han aumentado la información sobre las familias de factores de transcripción inmersos en procesos de respuesta a estrés abiótico y de biosíntesis de madera.

Dendrograma para la determinación de familias y motivos conservados de FTs de T. grandis

Los FTs de Teca con ortólogos en A. thaliana poseen dominios funcionales involucrados en la regulación de la expresión génica, y con procesos de estrés abiótico (Tabla I). Así, la familia de FTs HSF, clases A y B, es una de las familias encontradas más abundantes que posee el motivo de localización nuclear y mantiene la conformación de giro de hélice para lograr la interacción con el DNA (Harrison et al., 1994). Este dominio sirve para regular la respuesta al calor y otros tipos de estrés ambiental, siendo la planta perenne Mimulus guttatus la más próxima a T. grandis en motivos conservados (Figura 1).

Tabla I.

Motivos conservados evolutivamente de 18 factores de transcripción de T. grandis, pertenecientes a las familias MyB, HSF, HShT, ERF, bZIP, NAC, bHLH, Gata, Nuy, IIETFs y ARF

FTs
Tectona grandis 
Motivos Conservados 
Tg MyB1  QITEALKLQMEVQKRLHEQLEVQRQLQLRIDAQGKYLKKIIEEQQ 
Tg MyB2  IVKGPWSKEED 
Tg MyB3  DQEEDLIIRLHKLLGNRWSLIA 
Tg HSF1  FKHNNFSSFVRQLNTYGFKK 
Tg HSF2  FARDLLPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFSND 
Tg HShT1  KRRLT 
Tg ERF1  KEEFVHILRRQSTGFSRGSSKYRGVTLHKCGRWEARMGQFLGKK 
Tg ERF2  RKRKNQYRGIRQRPWGKWAAEIRDP 
Tg bZIP1  SNRESARRSRLRKQKHLD 
Tg NAC1  EWFFFCPRDRKYPNG 
Tg bHLH1  LNHVEAERQRREKLNQRFYALRAVVPNISKMDKASLLGDA 
Tg Gata1  LCNACGLMWANKG 
Tg Nuy1  REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFE 
Tg Nuy2  SRHLHAMRRPRGNGGRFL 
Tg Nuy3  RAKAELEKK 
Tg Nuy4  RKPYLHESRHLHA 
Tg IIETFs1  DEYFHCE 
Tg ARF1  RGQPRRHLLTTGWSTFVTSKRL 
Figura 1.

Árbol filogenético de las familias de los factores de transcripción diferencialmente expresados en xilema secundario de T. grandis, (bHLH, MyB, HSF, NAC, Mad box, bZIP, ARF, ERF, NY, IIIBTFs, IIETfs, gata zinc y Tsiid), son representados con los cuadrados de color negro. Los clúster representan las asociaciones de secuencias de aminoácidos de FTs con un porcentaje de similitud superior al 70%. El clado con más FTs es constituido por los FTs TgNuy1, TgNuy2, TgNuy3 y TgNuy4, la familia MyB y HSF tienen 3 factores de transcripción, del mismo modo son detalladas las demás familias de genes reguladores en Tectona grandis.

(1,52MB).

Dentro de las familias HSF, RAP, ARF, bHLH, MyB, NF-Y (FTs que regulan la síntesis de pared celular y estrés abiótico), los genes más relevantes fueron TgMyB1, TgMyB2, TgMyB3, TgHSF1, TgERF1, TgERF2, TgNuy1, TgNuy2 y TgNuy3.

El gen TgMyB1 correspondió con Myb-like de M. guttatus (mgv1a011009m) y P. trichocarpa (Potri.006G000800.5) (Figura 1), todos ellos conteniendo la secuencia conservada LHEQLE (Tabla I). El gen TgMyB2 correspondió con Myb-like de M. guttatus (mgv1a000686m) y P. trichocarpa (Potri.006G241700.3), TgMyB3 con Myb-like de M. guttatus (mgv1a020950m), Jatropha curcas (Jcr4S00199.80) y Prunus persica (ppa024533m) (Figura 1). TgHSF1, el cual posee dominios con interacción al DNA (Tabla I) mostró homología con M. guttatus (mgv1a022013m), P. trichocarpa (Potri.004G042600.1) y A. thaliana (AT4G36990.1). También, el gen TgERF1, caracterizado por regiones de aminoácidos que reconocen la secuencia GCCGCC en plantas, está relacionado con M. guttatus (mgv1a021246m) y T. aesticum (Tae060207), y el FTs TgERF2 con M. guttatus (mgv1a008553m) y Nicotiana tabacum (Nta002851). Además, la familia NF-Y presentó para el gen TgNuy1, homología con Utricularia gibba (Scf00915.g22704.t1) y M. guttatus (mgv1a018555m), TgNuy2 con M. guttatus (mgv1a010361m) y Vitis vinifera (GSVIVT01022601001), TgNuy3 con N. tabacum (Nta011673) y M. guttatus (mgv1a012967m).

Asimismo, analizando los dominios conservados de la familia de factores de transcripción MYB, se observa que los genes TgMyB2 y TgMyB3 mantienen el dominio de unión al DNA (Tabla I), teniendo patrones estructurales tipo hélice-giro-hélice y tres triptófanos para la formación de un núcleo hidrofóbico (Ogata et al., 1995). Por otro lado, las regiones conservadas del gen TgHSF1 (familia HSF, o Heat shock) poseen dominios de interacción proteína–proteína (Figura 2), también tipo hélice-giro-hélice (Kotak et al., 2004). Además, el gen TgHSF2 posee un dominio de interacción al DNA, indicando una mayor especificidad al DNA (Tabla I). El gen TgERF2 (de la familia ethylene response factor) posee un dominio rico en arginina relacionado con la unión al esqueleto azúcar-fosfato (Allen et al., 1998). También fueron encontrados los FTs TgbZIP1 (familia bZIP), TgbHLH1 (familia bHLH), factores de transcripción basales que mantienen un zíper de leucinas y de reconocimiento de promotores corriente arriba y corriente abajo, donde el dominio de TgbHLH1 se une a los promotores formando dímeros (Schumacher et al., 2000). Asimismo, fueron identificados los genes TgNuy1,TgNuy2, TgNuy3, TgNuy4 ricos en Gln, Ser, Thr y pertenecientes a la familia NF-YA, con dominios de interacción en el surco menor de DNA y el motivo CCAAT (Nardini et al., 2013). Finalmente, los dominios conservados de la familia de factores de transcripción NAC se caracterizan por poseer un dominio conservado NAC N-terminal. En este estudio, fue encontrado el gen TgNAC1 (Tabla I). Los genes de esta familia pueden interactuar y regular con otros FTs y al mismo tiempo unirse al DNA, no poseen motivos hélice-giro-hélice y generalmente la estructura del monómero de dominio es β-hoja antiparalela y doblada (Nole-Wilson & Krizek, 2000). Para los dominios conservados del gen TgARF1 se ha observado que los dímeros del motivo ARF se unen como pinzas moleculares y de reconocimiento específico en los promotores corriente arriba o corriente abajo (Boer et al., 2014).

Figura 2.

Interactoma de 19 FTs diferencialmente expresados en tejido xilemático de tallo en T. grandis. Se incluye la red de coexpresión, donde los FTs TgRAP1, TgRAP2, TgMyB1, TgHSF1, TgHShT1, TgHSF2, TgMyB3, TgNAC1, TgLieTFs1, TgNuy3 y TgNuy4 se interconectan para hacer emerger propiedades funcionales de las células. Asimismo, se muestran interacciones físicas entre los FTs TgHShT1-TgHSF1 y TgNuy3-TgNuy4-TgNuy1. Además, se presentan diferentes redes como predicciones, dominios de proteína compartidos y otros tipos de interacción.

(0,3MB).
Análisis topológico de la red de coexpresión de FTs del xilema secundario asociado a la respuesta de estrés abiótico en T. grandis

Los genes de A. thaliana en la red de coexpresión se dividen en grupos de acuerdo a su función (Figura 3), (Tabla II). De este modo, se identificaron genes relacionados a la respuesta de estrés abiótico. Se seleccionaron 301 genes enzimáticos y 19 FTs con un porcentaje de similitud superior al 70%, de los cuales 10 son de respuesta a estrés por calor, 16 responden a estrés por luz y temperatura, mientras que 108 genes están relacionados con procesos metabólicos celulares (Tabla II).

Figura 3.

Red de coexpresión de A. thaliana ortólogo con T. grandis que muestra respuesta a estrés como la alta intensidad de luz y calor, además de procesos metabólicos celulares como la fotosíntesis y biosíntesis de carbohidratos.

(1,15MB).
Tabla II.

Nodos de ontologías génicas más significativos. Son incluidos sus valores p y frecuencias de clúster, donde las descripciones con mayor porcentaje son representados por las actividades metabólicas y procesos celulares

GO-ID  Descripción  Valor p  Valor p Corregido  Frecuencia del clúster  Porcentaje 
15979  Fotosíntesis  3.16E-09  2.85E-06  12/301  5.00% 
9628  Respuesta al estímulo abiótico  9.69E-07  3.13E-04  32/301  13.40% 
8152  Procesos metabólicos  1.09E-06  3.13E-04  108/301  45.30% 
9408  Respuesta al calor  1.48E-06  3.13E-04  10/301  4.20% 
9266  Respuesta a estímulos de temperatura  1.73E-06  3.13E-04  16/301  6.70% 
9416  Respuesta a estímulos de luz  3.35E-05  4.19E-03  16/301  6.70% 
9314  Respuesta a radiación  5.05E-05  4.19E-03  16/301  6.70% 
9987  Procesos celulares  5.36E-05  4.19E-03  108/301  45.30% 
50896  Respuesta a estímulos  5.50E-05  4.19E-03  57/301  23.90% 
19684  Fotosíntesis, reacción a la luz  5.67E-05  4.19E-03  6/301  2.50% 
44271  Proceso de biosíntesis celular de compuesto de nitrógeno  6.00E-05  4.19E-03  14/301  5.80% 
30091  Reparación de proteínas  6.46E-05  4.19E-03  3/301  1.20% 
10206  Reparación de fotosistema  6.46E-05  4.19E-03  3/301  1.20% 
9765  Fotosíntesis, captador de luz  6.56E-05  4.19E-03  4/301  1.60% 
44281  Pequeña molécula de proceso metabólico  6.95E-05  4.19E-03  29/301  12.10% 
44237  Proceso metabólico celular  8.00E-05  4.51E-03  84/301  35.20% 
51188  Proceso de biosíntesis del cofactor  1.03E-04  5.49E-03  8/301  3.30% 
44238  Proceso metabólico primario  2.06E-04  1.03E-02  86/301  36.10% 
5975  Proceso metabólico de carbohidratos  2.93E-04  1.39E-02  20/301  4% 
44283  Pequeña molécula de proceso biosintético  3.97E-04  1.79E-02  17/301  7.10% 
5982  Metabolismo del almidón  6.33E-04  2.72E-02  4/301  1.60% 
9108  Proceso de biosíntesis de coenzima  9.13E-04  3.75E-02  5/301  2.10% 
9644  Respuesta a la alta intensidad de la luz  1.13E-03  4.42E-02  4/301  1.60% 

Por otro lado, los FTs TgHSF1, TgHSF2 y TgHShT1 responden a estrés de calor en T. grandis, existiendo interacciones físicas entre los nodos de TgHShT1 con TgHSF1 y TgNuy4-TgNuy3 con TgNuy1 (Figura 2). Extendiendo el modelo de predicción, se observa la interacción física de TgHSF2 con TgHShT1 y TgHSF1. La red de coexpresión entre nodos e interacción por aristas (Figura 2) están entrelazadas por los FTs TgRAP1, TgMyB1, TgHSF1, TgMyB3, TgNAC1, TgTsiid1, TgLieTFs1, TgNuy3, TgRAP2 y TgNuy4, integrando la información parcial sobre 15 FTs. Entre las familias de FTs de Teca existen 4 agrupaciones que mantienen dominios funcionales compartidos entre los genes, teniendo como primer grupo TgHSF2, TgHShT1, TgHSF, luego TgMyB1, TgMyB2, TgMyB3, siguiéndole TgNuy2, TgNuy3, TgNuy4 y finalmente TgRAP1, TgRAP2 (Figura 1) y (Figura 2).

Análisis de enriquecimiento funcional en genes de Teca

La obtención de las ontologías génicas se realizó con 19 factores de transcripción y 301 genes enzimáticos ortólogos a genes de A. thaliana involucrados en la regulación de respuesta a estrés abiótico y en la formación de pared celular. De ellos, 108 de los genes diferencialmente expresados tienen relación directa con procesos celulares y metabólicos (Figura 3) y 32 genes dan respuesta a estrés abiótico, calor, estrés oxidativo y alta intensidad de luz. Los genes TgHShT1, TgHSF1, TgHSF2 son posibles factores de transcripción de respuesta a estrés abiótico que regulan positivamente otros genes de T. grandis (Figura 2). Además, de los datos obtenidos, fueron detectados genes de FTs maestros (master regulators) que regulan el estrés abiótico en T. grandis. Entre ellos, fue encontrado el regulador master TgNaC1, involucrado en la regulación negativa de algunas funciones y ortólogo de NTL9 de A. thaliana (Yoon et al., 2008), quien responde a estrés osmótico y senescencia foliar. Asimismo, el FT TgHShT1 es ortólogo de AtHSFA2 y un regulador clave en la respuesta a calor inducida bajo estrés ambiental. El gen TgHShT1 regula la transcripción de varios genes implicados en defensa frente al estrés térmico, incrementando su transcripción rápidamente bajo señales de estrés oxidativo, y su inhibición conlleva a la disfunción de diferentes organelos y muerte celular (Liu et al., 2013; Nishizawa-Yokoi et al., 2010) (Archivos adicionales 3). Además, el gen TgHShT1 posee interacción con 14 genes ortólogos en Teca y de respuesta a estrés oxidativo (Figura 2). Asimismo, los genes TgERF1 y TgERF2 responden a procesos biológicos de crecimiento y desarrollo, así como a señales hormonales y respuesta a estrés biótico y abiótico. El gen TgMyB3 es ortólogo de MyB23 de A. thaliana, quien regula su propio promotor y está relacionado con especialización celular epidérmica y formación de tricomas (Kang et al., 2009; Kirik et al., 2001).

En la Figura 3 se muestra la comparación de un patrón de genes diferencialmente expresados de la especie modelo A. thaliana, ortólogos de T. grandis que poseen anotación biológica en funciones como respuesta a estrés abiótico tanto de estímulo de alta intensidad de luz como de respuesta a calor. Las ontologías y los genes relacionados a regulación biológica están soportados por la simulación de Benjamini y Hochberg, la cual asocia significativamente genes a determinadas funciones (i.e. respuesta a calor y alta iluminación) (Tabla II). En consecuencia, cuando se obtiene la red de coexpresión, se logra entender en mayor proporción el enriquecimiento funcional con la presencia de 320 nodos y 4,049 aristas, incluyendo genes relacionados con procesos metabólicos, fotosintéticos y de biosíntesis (Archivos adicionales 3).

DISCUSIÓN

La diversificación evolutiva de los factores de transcripción es fundamental para los procesos de adaptación de las diferentes especies frente a estímulos ambientales (Jin et al., 2014). Existen alrededor de un 45% de FTs específicos en plantas. En A. thaliana, aproximadamente un 5% del genoma se dedica a su codificación, manteniendo conservados los dominios de unión al DNA entre los miembros de cada familia de FTs (Riechmann, 2000). En este estudio, los 19 FTs pertenecientes a las familias bHLH, MyB, HSF, NAC, Mad box, bZIP, ARF, ERF, NY, IIIBTFs, IIETfs, gata zinc, Tsiid y los 301 genes enzimáticos diferencialmente expresados en xilema secundario de T. grandis cumplen funciones en procesos catabólicos, metabolismo de carbohidratos, regulación génica y respuesta enzimática al estrés biótico y abiótico (Galeano et al., 2015), producción de biopolímeros y procesos de xilogénesis. Estos FTs también fueron encontrados en los perfiles transcriptómicos de otros árboles como P. trichocarpa y E. grandis (Dharmawardhana, et al., 2010; Mizrachi et al., 2010). En particular, M. guttattus fue la especie más próxima a T. grandis, ya que mantiene dominios funcionales conservados en seis FTs ortólogos, ello debido probablemente a su cercanía taxonómica en el orden Lamiales (Scoville et al., 2012).

Por otro lado, dentro de los genes enzimáticos, se identificó el transcrito de ß-galactosidasa fundamental en la síntesis de carbohidratos, glicoproteínas y glicolípidos (Roach et al., 2011). También se encontraron genes enzimáticos como quinasas, esenciales en las vías de señalización para el crecimiento, desarrollo y percepción a las diversas respuestas de estrés ambiental en plantas (Ihnatowicz et al., 2008). Además, se encontraron genes que codifican enzimas relacionados con la actividad fotosintética y en procesos de fosforilación y activación de FTs a nivel de la membrana intracelular, regulados por reacciones químicas hormonales como el etileno y el ácido abscísico (Abe et al., 2003; Yoon et al., 2008; Zhou et al., 2014). La respuesta fisiológica de la planta a los cambios ambientales es dinámica a nivel de la expresión génica. En ese punto, los FTs maestros son seleccionados evolutivamente por las plantas para tener funciones esenciales en la corregulación de procesos metabólicos como la xilogénesis y adaptación a estrés ambiental (Banti et al., 2010; Lin et al., 2015), fenómenos que se evidencian analizando las redes de coexpresión, para describir los patrones de correlación entre los genes y lograr identificar biomarcadores (Consortium, 2000).

Así, para activar los procesos metabólicos es necesario que los motivos funcionales de los FTs interactúen físicamente con los promotores upstream para su regulación y generalmente interactúan físicamente entre ellos para regular la expresión génica (Lin et al., 2015; Obata & Fernie, 2012). Finalmente, es posible que existan diferencias en los motivos funcionales entre genes ortólogos de familias de factores de transcripción, que podrían explicar divergencias funcionales y en algunos casos se expresarían en variaciones fenotípicas (Carretero-Paulet et al., 2010; Jin et al., 2014).

CONCLUSIONES

Con la información del transcriptoma de T. grandis fue posible establecer y visualizar redes de interacción de genes diferencialmente expresados en el xilema secundario del tallo, apoyados por la búsqueda de minería y bases de datos con enriquecimiento ontológico. Así, con la información disponible y utilizando el software Cytoscape (herramienta para analizar, modelar y predecir funciones génicas), se identificaron FTs implicados en procesos lignocelulósicos y respuesta a estrés abiótico.

Los patrones evolutivos de los 19 FTs analizados aquí se mantienen conservados dentro de las familias y sub familias. Además, son importantes en la regulación génica, ya que fueron identificados a partir de los genes diferencialmente expresados (DERs) en el tejido del xilema secundario del tallo. Debido a que las funciones particulares de una proteína se determinan analizando su secuencia de residuos de aminoácidos, la evaluación de dominios conservados funcionales mediante genes ortólogos de T. grandis en A. thaliana es útil para identificar posibles funciones del gen (Consortium, 2000; Dameron et al., 2013), siendo fundamental hacer uso de esta especie modelo, ya que tiene abundante recurso bioinformático disponible. También, la base de datos PubMed fue útil para obtener publicaciones que documentan evidencia experimental encontradas con el programa pubtator para filtrar la información y optimizar la sistematización de datos, la predicción de genes y el soporte experimental. Finalmente, este estudio bioinformático aumenta los estudios funcionales de genes de interés en T. grandis, árbol de gran importancia biotecnológica.

AGRADECIMIENTOS

Los autores agradecen a la Escola Superior de Agricultura Luiz de Queiroz de la Universidade de São Paulo por el soporte financiero y bioinformático.

[Tominaga-Wada et al., 2012]
R. Tominaga-Wada, Y. Nukumizu, S. Sato, T. Kato, S. Tabata, T. Wada.
Functional Divergence of MYB-Related Genes, WEREWOLF and AtMYB23 in Arabidopsis. Bioscience.
Biotechnology, and Biochemistry, 76 (2012), pp. 883-887
https://doi.org/10.1271/bbb.110811
REFERENCIAS
[Abe et al., 2003]
H. Abe, T. Urao, T. Ito, M. Seki, K. Shinozaki.
Transcriptional Activators in Abscisic Acid Signaling.
Society, 15 (2003, January), pp. 63-78
https://doi.org/10.1105/tpc.006130.salt
[Allen et al., 1998]
M.D. Allen, K. Yamasaki, M. Ohme-Takagi, M. Tateno, M. Suzuki.
A novel mode of DNA recognition by a beta-sheet revealed by the solution structure of the GCC-box binding domain in complex with DNA.
The EMBO Journal, 17 (1998), pp. 5484-5496
https://doi.org/10.1093/emboj/17.18.5484
[Anish et al., 2015]
M.C. Anish, E.V. Anoop, R. Vishnu, B. Sreejith, C.M. Jijeesh.
Effect of growth rate on wood quality of teak (Tectona grandis L. f.): a comparative study of teak grown under differing site quality conditions.
Journal of the Indian Academy of Wood Science, 12 (2015), pp. 81-88
https://doi.org/10.1007/s13196-015-0147-1
[Ariel et al., 2007]
F.D. Ariel, P.A. Manavella, C.A. Dezar, R.L. Chan.
The true story of the HD-Zip family.
Trends in Plant Science, 12 (2007), pp. 419-426
https://doi.org/10.1016/j.tplants.2007.08.003
[Banti et al., 2010]
V. Banti, F. Mafessoni, E. Loreti, A. Alpi, P. Perata.
The Heat-Inducible Transcription Factor HsfA2 Enhances Anoxia Tolerance in Arabidopsis.
Plant Physiology, 152 (2010), pp. 1471-1483
https://doi.org/10.1104/pp.109.149815
[Boer et al., 2014]
D.R. Boer, A. Freire-Ríos, W.A.M. Van Den Berg, T. Saaki, I.W. Manfield, S. Kepinski, M. Coll.
Structural basis for DNA binding specificity by the auxin-dependent ARF transcription factors.
https://doi.org/10.1016/j.cell.201312.027
[Carretero-Paulet et al., 2010]
L. Carretero-Paulet, A. Galstyan, I. Roig-Villanova, J.F. Martínez-García, J.R. Bilbao-Castro, D.L. Robertson.
Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae.
Plant Physiology, 153 (2010), pp. 1398-1412
https://doi.org/10.1104/pp.110.153593
[Consortium, 2000]
T.G.O. Consortium.
Gene ontologie: Tool for the unification of biology.
Nature Genetics, 25 (2000), pp. 25-29
https://doi.org/10.1038/75556.Gene
[Dameron et al., 2013]
O. Dameron, C. Bettembourg, N. Le Meur.
Measuring the Evolution of Ontology Complexity: The Gene Ontology Case Study.
PLoS ONE, 8 (2013), pp. 1-18
https://doi.org/10.1371/journal.pone.0075993
[Dharmawardhana et al., 2010]
P. Dharmawardhana, A.M. Brunner, S.H. Strauss.
Genome-wide transcriptome analysis of the transition from primary to secondary stem development in Populus trichocarpa.
BMC Genomics, 11 (2010), pp. 150
https://doi.org/10.1186/1471-2164-11-150
[Diningrat et al., 2015]
D.S. Diningrat, S.M. Widiyanto, a. I. Pancoro, D. Shim, B. Panchangam, J.E. Carlson.
Transcriptome of Teak (Tectona grandis, L.f) in Vegetative to Generative Stages Development.
Journal of Plant Sciences, 10 (2015), pp. 1-14
https://doi.org/10.3923/jps.2015.1.14
[Fröhlich et al., 2007]
H. Fröhlich, N. Speer, A. Poustka, T. Beissbarth.
GOSim--an R-package for computation of information theoretic GO similarities between terms and gene products.
BMC Bioinformatics, 8 (2007), pp. 166
https://doi.org/10.1186/1471-2105-8-166
[Galeano et al., 2014]
E. Galeano, T.S. Vasconcelos, D.A. Ramiro, V.D.F. De Martin, H. Carrer.
Identification and validation of quantitative real-time reverse transcription PCR reference genes for gene expression analysis in teak (Tectona grandis L.f.).
BMC Research Notes, 7 (2014), pp. 464
https://doi.org/10.1186/1756-0500-7-464
[Galeano et al., 2015]
E. Galeano, T.S. Vasconcelos, M. Vidal, M.K. Mejía-Guerra, H. Carrer.
Large-scale transcriptional profiling of lignified tissues in Tectona grandis.
BMC Plant Biology, 15 (2015), pp. 221
https://doi.org/10.1186/s12870-015-0599-x
[Gill and Tuteja, 2010]
S.S. Gill, N. Tuteja.
Polyamines and abiotic stress tolerance in plants.
Plant Signaling & Behavior, 5 (2010), pp. 26-33
https://doi.org/10.4161/psb.5.1.10291
[Harrison et al., 1994]
C.J. Harrison, A.A. Bohm, H.C. Nelson.
Crystal structure of the DNA binding domain of the heat shock transcription factor.
Science, 263 (1994), pp. 224-227
https://doi.org/10.1126/science.8284672
[Ihnatowicz et al., 2008]
A. Ihnatowicz, P. Pesaresi, K. Lohrig, D. Wolters, B. Müller, D. Leister.
Impaired photosystem I oxidation induces STN7-dependent phosphorylation of the light-harvesting complex I protein Lhca4 in Arabidopsis thaliana.
Planta, 227 (2008), pp. 717-722
https://doi.org/10.1007/s00425-007-0650-8
[Jin et al., 2014]
J. Jin, H. Zhang, L. Kong, G. Gao, J. Luo.
PlantTFDB 3.0: A portal for the functional and evolutionary study of plant transcription factors.
Nucleic Acids Research, 42 (2014), pp. 1182-1187
https://doi.org/10.1093/nar/gkt1016
[Kang et al., 2009]
Y.H. Kang, V. Kirik, M. Hulskamp, K.H. Nam, K. Hagely, M.M. Lee, J. Schiefelbein.
The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis.
The Plant Cell, 21 (2009), pp. 1080-1094
https://doi.org/10.1105/tpc.108.063180
[Kirik et al., 2001]
V. Kirik, A. Schnittger, V. Radchuk, K. Adler, M. Hulskamp, H. Baumlein.
Ectopic expression of the Arabidopsis AtMYB23 gene induces differentiation of trichome cells.
Dev Biol, 235 (2001), pp. 366-377
https://doi.org/10.1006/dbio.2001.0287
[Kotak et al., 2004]
S. Kotak, M. Port, A. Ganguli, F. Bicker, P. Von Koskull-Döring.
Characterization of C-terminal domains of Arabidopsis heat stress transcription factors (Hsfs) and identification of a new signature combination of plant class a Hsfs with AHA and NES motifs essential for activator function and intracellular localization.
Plant Journal, 39 (2004), pp. 98-112
https://doi.org/10.1111/j.1365-313X.;1; 2004.02111.x
[Krause et al., 2006]
G.H. Krause, A. Gallé, A. Virgo, M. García, P. Bucic, P. Jahns, K. Winter.
High-light stress does not impair biomass accumulation of sun-acclimated tropical tree seedlings (Calophyllum longifolium Willd. and Tectona grandis L. f.).
Plant Biology, 8 (2006), pp. 31-41
https://doi.org/10.1055/s-2005-872901
[Lin et al., 2015]
L. Lin, M. Lucas, G. De Turco, T.W. Toal, A. Gaudinier, N.F. Young, S.M. Brady.
An Arabidopsis gene regulatory network for secondary cell wall synthesis.
Nature, 517 (2015), pp. 571-575
https://doi.org/10.1038/nature14099
[Liu et al., 2013]
J. Liu, N. Sun, M. Liu, J. Liu, B. Du, X. Wang, X. Qi.
An Autoregulatory Loop Controlling Arabidopsis HsfA2 Expression: Role of Heat Shock-Induced Alternative Splicing.
Plant Physiology, 162 (2013), pp. 512-521
https://doi.org/10.1104/pp.112.205864
[Matsui et al., 2008]
A. Matsui, J. Ishida, T. Morosawa, Y. Mochizuki, E. Kaminuma, T.A. Endo, M. Seki.
Arabidopsis transcriptome analysis under drought, cold, high-salinity and ABA treatment conditions using a tiling array.
Plant and Cell Physiology, 49 (2008), pp. 1135-1149
https://doi.org/10.1093/pcp/pcn101
[Mizrachi et al., 2010]
E. Mizrachi, C.A. Hefer, M. Ranik, F. Joubert, A.a. Myburg.
De novo assembled expressed gene catalog of a fast-growing Eucalyptus tree produced by Illumina mRNA-Seq.
BMC Genomics, 11 (2010), pp. 681
https://doi.org/10.1186/1471-2164-11-681\n1471-2164-11-681 [pii]
[Naika et al., 2013]
M. Naika, K. Shameer, O.K. Mathew, R. Gowda, R. Sowdhamini.
STIFDB2: An updated version of plant stress-responsive transcription factor database with additional stress signals, stress-responsive transcription factor binding sites and stress-responsive genes in Arabidopsis and rice. Plant and Cell Physiology.
, 54 (2013), pp. 1-15
https://doi.org/10.1093/pcp/pcs185
[Nardini et al., 2013]
M. Nardini, N. Gnesutta, G. Donati, R. Gatta, C. Forni, A. Fossati, R. … Mantovani.
Sequence-specific transcription factor NF-Y displays histone-like DNA binding and H2B-like ubiquitination.
https://doi.org/10.1016/j.cell.2012.11.047
[Nishizawa-Yokoi et al., 2010]
A. Nishizawa-Yokoi, H. Tainaka, E. Yoshida, M. Tamoi, Y. Yabuta, S. Shigeoka.
The 26S proteasome function and Hsp90 activity involved in the regulation of HsfA2 expression in response to oxidative stress.
Plant and Cell Physiology, 51 (2010), pp. 486-496
https://doi.org/10.1093/pcp/pcq015
[Nole-Wilson and Krizek, 2000]
S. Nole-Wilson, B.A. Krizek.
DNA binding properties of the Arabidopsis floral development protein AINTEGUMENTA.
Nucleic Acids Res, 28 (2000), pp. 4076-4082
https://doi.org/10.1093/nar/28.21.4076
[Obata and Fernie, 2012]
T. Obata, A.R. Fernie.
The use of metabolomics to dissect plant responses to abiotic stresses. Cellular and Molecular Life Sciences.
, 69 (2012), pp. 3225-3243
https://doi.org/10.1007/s00018-012-1091-5
[Ogata et al., 1995]
K. Ogata, S. Morikawa, H. Nakamura, H. Hojo, S. Yoshimura, R. Zhang, A. Sarai.
Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
Nature Structural Biology, 2 (1995), pp. 309-320
https://doi.org/10.1038/nsb0495-309
[Prasch and Sonnewald, 2013]
C.M. Prasch, U. Sonnewald.
Simultaneous application of heat, drought, and virus to Arabidopsis plants reveals significant shifts in signaling networks.
Plant Physiology, 162 (2013), pp. 1849-1866
https://doi.org/10.1104/pp.113.221044
[Quiala et al., 2012]
E. Quiala, M.J. Cañal, R. Rodríguez, N. Yagüe, M. Chávez, R. Barbón, L. Valledor.
Proteomic profiling of Tectona grandis L. leaf.
Proteomics, 12 (2012), pp. 1039-1044
https://doi.org/10.1002/pmic.201100183
[Riechmann, 2000]
J.L. Riechmann.
Arabidopsis Transcription Factors: Genome-Wide Comparative Analysis Among Eukaryotes.
Science, 290 (2000), pp. 2105-2110
https://doi.org/10.1126/science.290.5499.2105
[Roach et al., 2011]
M.J. Roach, N.Y. Mokshina, A. Badhan, A.V. Snegireva, N. Hobson, M.K. Deyholos, T.A. Gorshkova.
Development of Cellulosic Secondary Walls in Flax Fibers Requires -Galactosidase.
Plant Physiology, 156 (2011), pp. 1351-1363
https://doi.org/10.1104/pp.111.172676
[Sauvé et al., 2004]
S. Sauvé, L. Tremblay, P. Lavigne.
The NMR solution structure of a mutant of the max b/HLH/LZ free of DNA: Insights into the specific and reversible DNA binding mechanism of dimeric transcription factors.
Journal of Molecular Biology, 342 (2004), pp. 813-832
https://doi.org/10.1016/j.jmb.2004.07.058
[Schumacher et al., 2000]
M.A. Schumacher, R.H. Goodman, R.G. Brennan.
The structure of a CREB bZIP somatostatin CRE complex reveals the basis for selective dimerization and divalent cation-enhanced DNA binding.
Journal of Biological Chemistry, 275 (2000), pp. 35242-35247
https://doi.org/10.1074/jbc.M007293200
[Scoville et al., 2012]
A.G. Scoville, L.L. Barnett, S. Bodbyl-roels, J.K. Kelly, C. Lena.
NIH Public Access, 191 (2012), pp. 251-263
https://doi.org/10.1111/j.1469-8137.2011.03656.x.Differential
[Sowdhamini et al., 2009]
R. Sowdhamini, K. Shameer, S. Ambika, S.M. Varghese, N. Karaba, M. Udayakumar.
STIFDB Arabidopsis stress responsive transcription factor dataBase.
International Journal of Plant Genomics, 2009., (2009),
https://doi.org/10.1155/2009/583429
[Sundar et al., 2008]
A.S. Sundar, S.M. Varghese, K. Shameer, N. Karaba, M. Udayakumar, R. Sowdhamini.
STIF: Identification of stress-upregulated transcription factor binding sites in Arabidopsis thaliana.
Bioinformation, 2 (2008), pp. 431-437
https://doi.org/10.6026/97320630002431
[Udvardi et al., 2007]
M.K. Udvardi, K. Kakar, M. Wandrey, O. Montanari, J. Murray, A. Andriankaja, C.D. Town.
Legume Transcription Factors: Global Regulators of Plant Development and Response to the Environment.
Plant Physiology, 144 (2007), pp. 538-549
https://doi.org/10.1104/pp.107.098061
[Wan et al., 2012]
L. Wan, X. Yan, T. Chen, F. Sun.
Modeling RNA degradation for RNA-Seq with applications.
Biostatistics, 13 (2012), pp. 734-747
https://doi.org/10.1093/biostatistics/kxs001
[Wei et al., 2012]
C.-H. Wei, B.R. Harris, D. Li, T.Z. Berardini, E. Huala, H.-Y. Kao, Z. Lu.
Accelerating literature curation with text-mining tools: a case study of using PubTator to curate genes in PubMed abstracts.
Database: The Journal of Biological Databases and Curation, 2012, bas041., (2012),
https://doi.org/10.1093/database/bas041
[Yoon et al., 2008]
H.K. Yoon, S.G. Kim, S.Y. Kim, C.M. Park.
Regulation of leaf senescence by NTL9-mediated osmotic stress signaling in Arabidopsis.
Mol. Cells, 25 (2008), pp. 438-445
[Zhou et al., 2014]
J. Zhou, Y. Yang, J. Yu, L. Wang, X. Yu, M. Ohtani, Q. Zhuge.
Responses of Populus trichocarpa galactinol synthase genes to abiotic stresses.
Journal of Plant Research, 127 (2014), pp. 347-358
https://doi.org/10.1007/s10265-013-0597-8
Copyright © 2017. Universidad Nacional Autónoma de México, Facultad de Estudios Superiores Zaragoza
Opciones de artículo
Herramientas